PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA06G27990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 344aa    MW: 37459.4 Da    PI: 7.9721
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA06G27990.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.31.6e-3667144178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC  +l   key+r+h+vCe h+k+  v+v+g+ +rfCqqCsrfh+ sefD+ekrsCrrrL++hn+rrrk+q+
  ONIVA06G27990.1  67 RCQVEGCGLELGGYKEYYRKHRVCEPHTKCLRVVVAGQDRRFCQQCSRFHAPSEFDQEKRSCRRRLSDHNARRRKPQT 144
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.8E-2963129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.87265142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-3666148IPR004333Transcription factor, SBP-box
PfamPF031101.1E-2868141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MECNPVSSST TSSSLLWDWD ATASAEPPPP PGKRGGRDSS SASASAKRGR SAAAAGDAAA  60
VAAEAPRCQV EGCGLELGGY KEYYRKHRVC EPHTKCLRVV VAGQDRRFCQ QCSRFHAPSE  120
FDQEKRSCRR RLSDHNARRR KPQTDVFAFG SGTLPRSLFD DRRQISFAWD NNAPLNHANT  180
TSSSSWTSDL QLSQVMDISK RSRKAGADSA NIRLSNALPT LCHDTNELLP IKGADASETA  240
SKLDGALDVQ RALSLLSASS RGLTDPGHQT SSIIQFTNSN QNSTLPSVPS EGNSNVPFWV  300
DGQHQAVEPQ VFQFTMDTGN TVFPDLERIK PSYESSMFGL NQIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-22681411184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641499.10.0PREDICTED: squamosa promoter-binding-like protein 11
SwissprotQ653Z50.0SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLA0A0E0HUK20.0A0A0E0HUK2_ORYNI; Uncharacterized protein
STRINGBGIOSGA020731-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.41e-39squamosa promoter binding protein-like 10